SMG5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05264

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SMG5 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 950-1016 of human SMG5 (NP_056142.2). DSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMG5 Antibody - Azide and BSA Free

Western Blot: SMG5 AntibodyAzide and BSA Free [NBP3-05264]

Western Blot: SMG5 AntibodyAzide and BSA Free [NBP3-05264]

Western Blot: SMG5 Antibody [NBP3-05264] - Analysis of extracts of various cell lines, using SMG5 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Applications for SMG5 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMG5

SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).[supplied by OMIM]

Alternate Names

EST1BFLJ12287, EST1-like protein B, Est1p-like protein B, ever shorter telomeres 1B, hSMG-5, KIAA1089FLJ34864, LPTS interacting protein, LPTS-interacting protein, LPTSRP1, LPTS-RP1EST1 telomerase component homolog B, protein SMG5, RP11-54H19.7, SMG-5, SMG-5 homolog, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)

Gene Symbol

SMG5

Additional SMG5 Products

Product Documents for SMG5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMG5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SMG5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SMG5 Antibody - Azide and BSA Free and earn rewards!

Have you used SMG5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies