SNTB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86815

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SNTB2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNTB2. Peptide sequence: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SNTB2 Antibody - BSA Free

Western Blot: SNTB2 Antibody [NBP2-86815]

Western Blot: SNTB2 Antibody [NBP2-86815]

Western Blot: SNTB2 Antibody [NBP2-86815] - Host: Rabbit. Target Name: SNTB2. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/mlSNTB2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells

Applications for SNTB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNTB2

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.

Alternate Names

D16S2531E, EST25263, SNT2B2dystrophin-associated protein A1, 59kD, basic component 2, SNT3beta-2-syntrophin, SNTLsyntrophin-3, syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2), syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2), Syntrophin-3,59 kDa dystrophin-associated protein A1 basic component 2, Syntrophin-like

Gene Symbol

SNTB2

Additional SNTB2 Products

Product Documents for SNTB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNTB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNTB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNTB2 Antibody - BSA Free and earn rewards!

Have you used SNTB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies