SP-D Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58977

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SFTPD(surfactant, pulmonary-associated protein D) The peptide sequence was selected from the middle region of SFTPD (NP_003010). Peptide sequence PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SP-D Antibody - BSA Free

Western Blot: SP-D Antibody [NBP1-58977]

Western Blot: SP-D Antibody [NBP1-58977]

Western Blot: Surfactant protein D Antibody [NBP1-58977] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for SP-D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SP-D

SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant. SFTPD binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieti

Long Name

Surfactant Pulmonary Associated Protein D

Alternate Names

Collectin 7, PSP-D, SFTP4, SFTPD, SPD

Entrez Gene IDs

6441 (Human)

Gene Symbol

SFTPD

UniProt

Additional SP-D Products

Product Documents for SP-D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SP-D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SP-D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SP-D Antibody - BSA Free and earn rewards!

Have you used SP-D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SP-D Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Could you please provide a detailed protocol on how to reconstitute it?

    A: To reconstitute this antibody, you should centrifuge the vial at 12,000 x g for 20 seconds, then add 50ul of distilled water. You should then vortex the vial, and centrifuge it again to pellet the solution. The final concentration of the antibody is 1mg/ml in PBS with 2% sucrose.

  • Q: Here a customer intends to buy our Surfactant protein D Antibody, NBP1-58977. He wonders whether it is suitable for rabbit lung tissue or cells. Can you so kind to help him and me?

    A: D antibody with catalogue number NBP1-58977 has been validated for Western blotting with samples from rabbit, although other applications have not yet been tested. According to the testing data of the Human Protein Atlas, who are a group that have generated protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines, surfactant protein D is highly expressed in the human lung. Unfortunately I do not have similar data available for rabbit, and your customer may wish to consult the literature for further information.

  • Q: Could you please provide a detailed protocol on how to reconstitute it?

    A: To reconstitute this antibody, you should centrifuge the vial at 12,000 x g for 20 seconds, then add 50ul of distilled water. You should then vortex the vial, and centrifuge it again to pellet the solution. The final concentration of the antibody is 1mg/ml in PBS with 2% sucrose.

  • Q: Here a customer intends to buy our Surfactant protein D Antibody, NBP1-58977. He wonders whether it is suitable for rabbit lung tissue or cells. Can you so kind to help him and me?

    A: D antibody with catalogue number NBP1-58977 has been validated for Western blotting with samples from rabbit, although other applications have not yet been tested. According to the testing data of the Human Protein Atlas, who are a group that have generated protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines, surfactant protein D is highly expressed in the human lung. Unfortunately I do not have similar data available for rabbit, and your customer may wish to consult the literature for further information.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...