SPAM1 Synthetic Peptide

Novus Biologicals | Catalog # NBP2-83580PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

Synthetic

Applications

Western Blot, Antibody Competition
View all SPAM1 Small Molecules and Peptides »

Product Specifications

Description

55kDa synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP (Uniprot: P38567)

The peptide is characterized by mass spectroscopy

Purity

Multi-step

Predicted Molecular Mass

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Application Notes

This peptide is useful as a blocking peptide for NBP2-83580. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings.

Protein / Peptide Type

Synthetic Peptide

Formulation, Preparation, and Storage

NBP2-83580PEP
Concentration Lyoph
Reconstitution Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Calculators

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: SPAM1

Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Long Name

Sperm Adhesion Molecule 1

Alternate Names

HYA1, HYAL3, HYAL5, PH20, SPAG15

Gene Symbol

SPAM1

Additional SPAM1 Products

Product Documents for SPAM1 Synthetic Peptide

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPAM1 Synthetic Peptide

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for SPAM1 Synthetic Peptide

There are currently no reviews for this product. Be the first to review SPAM1 Synthetic Peptide and earn rewards!

Have you used SPAM1 Synthetic Peptide?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card