SRD5A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59525

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Monkey

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SRD5A2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SRD5A2 (steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)) The peptide sequence was selected from the N terminal of SRD5A2)(50ug). Peptide sequence KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SRD5A2 Antibody - BSA Free

Western Blot: SRD5A2 Antibody [NBP1-59525]

Western Blot: SRD5A2 Antibody [NBP1-59525]

Western Blot: SRD5A2 Antibody [NBP1-59525] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SRD5A2 Antibody [NBP1-59525]

Western Blot: SRD5A2 Antibody [NBP1-59525]

Western Blot: SRD5A2 Antibody [NBP1-59525] - Lanes: Lane 1 : 50ug monkey brain extract Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1 : 10,000.

Applications for SRD5A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRD5A2

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

Long Name

3-oxo-5-alpha-steroid 4-dehydrogenase 2

Alternate Names

5 alpha-SR2, S5AR 2, SR type 2

Gene Symbol

SRD5A2

UniProt

P31213 (Human)

Additional SRD5A2 Products

Product Documents for SRD5A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SRD5A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SRD5A2 Antibody - BSA Free

Customer Reviews for SRD5A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRD5A2 Antibody - BSA Free and earn rewards!

Have you used SRD5A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies