SRP68 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57137

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SRP68 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SRP68(signal recognition particle 68kDa) The peptide sequence was selected from the N terminal of SRP68. Peptide sequence EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SRP68 Antibody - BSA Free

Western Blot: SRP68 Antibody [NBP1-57137]

Western Blot: SRP68 Antibody [NBP1-57137]

Western Blot: SRP68 Antibody [NBP1-57137] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for SRP68 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRP68

The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. This gene encodes the 68kDa component of the SRP. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.

Alternate Names

signal recognition particle 68 kDa protein, signal recognition particle 68kD, signal recognition particle 68kDa

Gene Symbol

SRP68

UniProt

Q9UHB9 (Human)

Additional SRP68 Products

Product Documents for SRP68 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SRP68 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRP68 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRP68 Antibody - BSA Free and earn rewards!

Have you used SRP68 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies