STAC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09669

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all STAC2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2 (NP_945344). Peptide sequence TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for STAC2 Antibody - BSA Free

Western Blot: STAC2 Antibody [NBP3-09669]

Western Blot: STAC2 Antibody [NBP3-09669]

Western Blot: STAC2 Antibody [NBP3-09669] - STAC2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP3-09669 with 1:200 dilution. Western blot was performed using NBP3-09669 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: STAC2 IP with NBP3-09669 in HEK293

Applications for STAC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STAC2

Alternate Names

24b2/STAC2, MGC129694, SH3 and cysteine rich domain 2,24b2, SH3 and cysteine-rich domain-containing protein 2, Src homology 3 and cysteine-rich domain-containing protein 2

Gene Symbol

STAC2

Additional STAC2 Products

Product Documents for STAC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STAC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STAC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STAC2 Antibody - BSA Free and earn rewards!

Have you used STAC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies