STARD8 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-69098
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8.
Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for STARD8 Antibody - BSA Free
Western Blot: STARD8 Antibody [NBP1-69098]
Western Blot: STARD8 Antibody [NBP1-69098] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.Western Blot: STARD8 Antibody [NBP1-69098]
Western Blot: STARD8 Antibody [NBP1-69098] - Lanes: Lane 1 : 30ug STARD8 transfected HEK293T lysate Lane 2: 30ug HEK293T lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 10,000 Gene name: STARD8 Submitted by: Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O. L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong.Applications for STARD8 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: STARD8
Alternate Names
ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3
Gene Symbol
STARD8
Additional STARD8 Products
Product Documents for STARD8 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for STARD8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for STARD8 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review STARD8 Antibody - BSA Free and earn rewards!
Have you used STARD8 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...