STARD8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69098

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for STARD8 Antibody - BSA Free

Western Blot: STARD8 Antibody [NBP1-69098]

Western Blot: STARD8 Antibody [NBP1-69098]

Western Blot: STARD8 Antibody [NBP1-69098] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.
Western Blot: STARD8 Antibody [NBP1-69098]

Western Blot: STARD8 Antibody [NBP1-69098]

Western Blot: STARD8 Antibody [NBP1-69098] - Lanes: Lane 1 : 30ug STARD8 transfected HEK293T lysate Lane 2: 30ug HEK293T lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 10,000 Gene name: STARD8 Submitted by: Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O. L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong.

Applications for STARD8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STARD8

This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.

Alternate Names

ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3

Gene Symbol

STARD8

Additional STARD8 Products

Product Documents for STARD8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STARD8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STARD8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STARD8 Antibody - BSA Free and earn rewards!

Have you used STARD8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...