STEAP2 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP1-83100PEP
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP1-83100PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: STEAP2
Long Name
Alternate Names
Gene Symbol
Additional STEAP2 Products
Product Documents for STEAP2 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for STEAP2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for STEAP2 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review STEAP2 Recombinant Protein Antigen and earn rewards!
Have you used STEAP2 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for STEAP2 Recombinant Protein Antigen
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.
-
Q: I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
A: We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
Q: NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?
A: I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.