TCEB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83629

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TCEB1. Peptide sequence: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TCEB1 Antibody - BSA Free

Western Blot: TCEB1 Antibody [NBP2-83629]

Western Blot: TCEB1 Antibody [NBP2-83629]

Western Blot: TCEB1 Antibody [NBP2-83629] - WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

Applications for TCEB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCEB1

Elongin C (also known as RNA polymerase II transcription factor SIII p15 subunit and transcription elongation factor B polypeptide 1) is a 15 kD member of the SKP1 family. Elongin functions as a regulatory subunit of a general transcription elongation factor that increases RNA polymerase II transcription elongation past template-encoded arresting sites in the nucleus. The Elongin BC complex acts as adaptor to link Elongin A, VHL, WSB1 or SOCS1 with a module of CUL2 or CUL5 and RBX1 to form E3 ubiquitin ligases. The Poly6131 antibody recognizes the human and mouse elongin C protein and has been shown to be useful for Western blotting.

Long Name

TCEB1

Alternate Names

ELOC, elongin 15 kDa subunit, elongin-C, RNA polymerase II transcription factor SIII subuni, SIII, SIII p15, transcription elongation factor B (SIII), polypept, transcription elongation factor B polypeptide 1, transcription elongation factor B subunit 1

Gene Symbol

ELOC

Additional TCEB1 Products

Product Documents for TCEB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TCEB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCEB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCEB1 Antibody - BSA Free and earn rewards!

Have you used TCEB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...