TCF7L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10972

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TCF7L2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2 (NP_110383). Peptide sequence MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TCF7L2 Antibody - BSA Free

Western Blot: TCF7L2 Antibody [NBP3-10972]

Western Blot: TCF7L2 Antibody [NBP3-10972]

Western Blot: TCF7L2 Antibody [NBP3-10972] - Western blot analysis using NBP3-10972 on Human HeLa as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for TCF7L2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCF7L2

TCF7L2, or TCF4, is a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. TCF7L2 has been implicated in glucose homeostasis through the regulation of pro-glucagon gene expression, which encodes glucagon-like peptide 1 (GLP-1). Genetic variants of TCF7L2 have been linked to type 2 diabetes, and it has specifically been shown to have an important role in the regulation of both 946;-cell survival and function (4). Several splicing isoforms for TCF7L2 have been shown to be differentially expressed in tissues during cancer progression (3), and gene targeting studies indicate that TCF7L2 is required to maintain the crypt stem cells of the small intestine (1, 2).

Alternate Names

HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)

Gene Symbol

TCF7L2

Additional TCF7L2 Products

Product Documents for TCF7L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TCF7L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCF7L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCF7L2 Antibody - BSA Free and earn rewards!

Have you used TCF7L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies