TDAG8/GPR65 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58485

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TDAG8/GPR65 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TDAG8/GPR65 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TDAG8/GPR65 Antibody [NBP2-58485]

Immunocytochemistry/ Immunofluorescence: TDAG8/GPR65 Antibody [NBP2-58485]

Immunocytochemistry/Immunofluorescence: TDAG8/GPR65 Antibody [NBP2-58485] - Staining of human cell line RH-30 shows localization to cytosol. Antibody staining is shown in green.

Applications for TDAG8/GPR65 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TDAG8/GPR65

GPR65 (TDAG8), a Lysophospholipid/Lysosphingolipid Receptor, is a molecular target for psychosine, a toxic lipid formed by the breakdown of galactosylceramide (cerebroside). A build-up of psychosine, caused by the lack of galactosylceramidase, results in the death of the myelin-synthesizing cells, oligodendrocytes, which is associated with Krabbe disease. GPR65 has been reported in human in peripheral blood leukocytes, spleen, lymph node, and thymus. ESTs have been isolated from human B-cell/lung/testis, brain/lung/testis, pancreas/spleen, lung/spleen, leukocyte, embryo, kidney, liver/spleen, thyroid, and vessel libraries.

Long Name

G Protein-coupled Receptor 65

Alternate Names

GPR65, Psychosine Receptor

Gene Symbol

GPR65

Additional TDAG8/GPR65 Products

Product Documents for TDAG8/GPR65 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TDAG8/GPR65 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TDAG8/GPR65 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TDAG8/GPR65 Antibody - BSA Free and earn rewards!

Have you used TDAG8/GPR65 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies