Tenascin X Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25332PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all Tenascin X Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tenascin X

Source: E.coli

Amino Acid Sequence: PSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25332It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25332PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Tenascin X

Tenascin is a high molecular weight, multifunctional, extracellular matrix glycoprotein expressed in association with mesenchymal-epithelial interactions during development and in the neovasculature and stroma of undifferentiated tumors (Erickson and Bourdon 1989).It has been described under a variety of names: cytotactin, hexabrachion protein, J1, myotendinous antigen (MI) and glioma mesenchymal extracellular matrix (GMEM).The tenascin molecule is a disulfide-linked hexamer.The expression of tenascin is associated with development and growth, both normal and pathological, whereas the distribution in normal adult tissue is restricted.

Alternate Names

HXBL, TNX, TNXB, TNXBS, XB, XB-S

Gene Symbol

TNXB

Additional Tenascin X Products

Product Documents for Tenascin X Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tenascin X Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for Tenascin X Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Tenascin X Recombinant Protein Antigen and earn rewards!

Have you used Tenascin X Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes