Tetraspanin-31 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62311

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN31 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN31(tetraspanin 31) The peptide sequence was selected form the middle region of TSPAN31. Peptide sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tetraspanin-31 Antibody - BSA Free

Western Blot: Tetraspanin-31 Antibody [NBP1-62311]

Western Blot: Tetraspanin-31 Antibody [NBP1-62311]

Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: Tetraspanin-31 Antibody [NBP1-62311]

Western Blot: Tetraspanin-31 Antibody [NBP1-62311]

Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Expressed in E. coli, concentration 1 ug/ml.

Applications for Tetraspanin-31 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN31

TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.

Long Name

Tetraspanin 31

Alternate Names

SAS, Tetraspanin-31, Transmembrane 4 Protein

Gene Symbol

TSPAN31

OMIM

NP_005972 (Human)

UniProt

Q12999 (Human)

Additional TSPAN31 Products

Product Documents for Tetraspanin-31 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tetraspanin-31 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Tetraspanin-31 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tetraspanin-31 Antibody - BSA Free and earn rewards!

Have you used Tetraspanin-31 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies