TGF-alpha Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-87501PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all TGF-alpha Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGFA.

Source: E. coli

Amino Acid Sequence: LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87501.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-87501PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TGF-alpha

Transforming growth factor alpha (TGFalpha) is an acid- and heat-stable 50 amino acid protein originally found in rodents and humans. TGFalpha is 33% homologous at the amino acid level to epidermal growth factor (EGF). TGFalpha binds to the EGF receptor, mediates tyrosine phosphorylation of the receptor and promotes anchorage-independent growth of normal rat fibroblasts in soft agar in the presence of transforming growth factor beta. TGFalpha is secreted by a variety of transformed cells and tumors, embryonic cells and some normal adult cells. TGFalpha bioactivity has been found in the urine of cancer patients. It has been suggested that it may act as an autocrine growth factor for the induction or maintenance of malignancy.

Long Name

Transforming Growth Factor alpha

Alternate Names

TGFA, TGFalpha

Gene Symbol

TGFA

Additional TGF-alpha Products

Product Documents for TGF-alpha Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TGF-alpha Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for TGF-alpha Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review TGF-alpha Recombinant Protein Antigen and earn rewards!

Have you used TGF-alpha Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes