THAP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57825

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all THAP3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THAP3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: THAP3 Antibody [NBP2-57825]

Immunocytochemistry/ Immunofluorescence: THAP3 Antibody [NBP2-57825]

Immunocytochemistry/Immunofluorescence: THAP3 Antibody [NBP2-57825] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: THAP3 Antibody [NBP2-57825]

Immunohistochemistry-Paraffin: THAP3 Antibody [NBP2-57825]

Immunohistochemistry-Paraffin: THAP3 Antibody [NBP2-57825] - Immunohistochemical staining of human kidney shows nuclear positivity in cells in tubules and cells in glomeruli.
THAP3 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: THAP3 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: THAP3 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-THAP3 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for THAP3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THAP3

Alternate Names

MGC33488, THAP domain containing, apoptosis associated protein 3, THAP domain-containing protein 3

Gene Symbol

THAP3

Additional THAP3 Products

Product Documents for THAP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for THAP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THAP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THAP3 Antibody - BSA Free and earn rewards!

Have you used THAP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies