TIGD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09640

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TIGD5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse TIGD5 (NP_848761). Peptide sequence PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIGD5 Antibody - BSA Free

Western Blot: TIGD5 Antibody [NBP3-09640]

Western Blot: TIGD5 Antibody [NBP3-09640]

Western Blot: TIGD5 Antibody [NBP3-09640] - Western blot analysis of TIGD5 in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Applications for TIGD5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIGD5

The protein encoded by the TIGD5 gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons inhumans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 andmariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function ofthis gene is not known. (provided by RefSeq)

Alternate Names

tigger transposable element derived 5, tigger transposable element-derived protein 5

Gene Symbol

TIGD5

Additional TIGD5 Products

Product Documents for TIGD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIGD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIGD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIGD5 Antibody - BSA Free and earn rewards!

Have you used TIGD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies