TMEM49 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88441

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TMEM49. Peptide sequence: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TMEM49 Antibody - BSA Free

Western Blot: TMEM49 Antibody [NBP2-88441]

Western Blot: TMEM49 Antibody [NBP2-88441]

Western Blot: TMEM49 Antibody [NBP2-88441] - Host: Rabbit. Target Name: VMP1. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TMEM49 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM49

Transmembrane protein 49 (TMEM49), also known as vacuole membrane protein 1 (VMP1), is an endoplasmic reticulum (ER)-localized protein that plays an important role in autophagy and, specifically, autophagosome formation (1). TMEM49/VMP1 is synthesized as 406 amino acid (aa) transmembrane protein containing a VTT (VMP1-TMEM41b-TVP38) domain and with a theoretical molecular weight of 46 kDa (1,2). TMEM49 helps regulate ER contacts with membranes such as isolation membranes, mitochondria, endosomes, and lipid droplets (1). TMEM49/VMP1 deficiency leads to tighter ER contacts and, in the context of autophagy, results in failure of the autophagosome and lysosome to fuse and eventual disruption of autophagic flux (1).

TMEM49/VMP1 was first implicated in pancreatitis and its overexpression, together with KRAS oncogene activation, leads to development of pancreatic ductal adenocarcinoma (PDAC) (3). Aside from pancreatitis, TMEM49/VMP1 is also associated with a number of other pathologies including cancer, inflammatory bowel disease, and, potentially, neurodegenerative disorders such as Parkinson's Disease (PD) and Alzheimer's Disease (AD) (1). It is suggested that TMEM49/VMP1 deficiency in neurons results in disrupted autophagy and protein aggregation, increased ER-membrane contacts, and dysfunctional mitochondrial homeostasis, all of which contribute to neurodegeneration (1).

References

1. Wang, P., Kou, D., & Le, W. (2020). Roles of VMP1 in Autophagy and ER-Membrane Contact: Potential Implications in Neurodegenerative Disorders. Frontiers in molecular neuroscience, 13, 42. https://doi.org/10.3389/fnmol.2020.00042

2. Uniprot (Q96GC9)

3. Iovanna J. L. (2016). Autophagy Induced during Pancreatitis Promotes KRAS-Dependent Transformation in the Pancreas. Frontiers in oncology, 6, 226. https://doi.org/10.3389/fonc.2016.00226

Alternate Names

DKFZp566I133, EPG3, TDC1, transmembrane protein 49TMEM49, vacuole membrane protein 1

Gene Symbol

VMP1

Additional TMEM49 Products

Product Documents for TMEM49 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEM49 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMEM49 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM49 Antibody - BSA Free and earn rewards!

Have you used TMEM49 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...