TRIM13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88467

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM13. Peptide sequence: KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM13 Antibody - BSA Free

Western Blot: TRIM13 Antibody [NBP2-88467]

Western Blot: TRIM13 Antibody [NBP2-88467]

Western Blot: TRIM13 Antibody [NBP2-88467] - WB Suggested Anti-RFP2 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysateTRIM13 is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for TRIM13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM13

Ret finger protein 2 This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 6. Multiple alternatively spliced transcript variants have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant RFP2.

Alternate Names

B-cell chronic lymphocytic leukemia tumor suppressor Leu5, CLL-associated RING finger, E3 ubiquitin-protein ligase TRIM13, EC 6.3.2.-, LEU5CAR, Leukemia-associated protein 5, Putative tumor suppressor RFP2, Ret finger protein 2RING finger protein 77, RFP2DLEU5, RNF77Leu5, tripartite motif containing 13, tripartite motif protein 13, tripartite motif-containing 13, Tripartite motif-containing protein 13

Gene Symbol

TRIM13

Additional TRIM13 Products

Product Documents for TRIM13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM13 Antibody - BSA Free and earn rewards!

Have you used TRIM13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...