TRIM14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10346

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TRIM14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM14 (NP_150090). Peptide sequence SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRIM14 Antibody - BSA Free

Western Blot: TRIM14 Antibody [NBP3-10346]

Western Blot: TRIM14 Antibody [NBP3-10346]

Western Blot: TRIM14 Antibody [NBP3-10346] - Western blot analysis using NBP3-10346 on Human Liver as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for TRIM14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM14

TRIM14 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. [provided by RefSeq]

Alternate Names

KIAA0129tripartite motif-containing 14, tripartite motif containing 14, tripartite motif protein TRIM14, tripartite motif-containing protein 14

Gene Symbol

TRIM14

Additional TRIM14 Products

Product Documents for TRIM14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM14 Antibody - BSA Free and earn rewards!

Have you used TRIM14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies