TRIM35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88471

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TRIM35 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE TRIM35. Peptide sequence: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM35 Antibody - BSA Free

Western Blot: TRIM35 Antibody [NBP2-88471]

Western Blot: TRIM35 Antibody [NBP2-88471]

Western Blot: TRIM35 Antibody [NBP2-88471] - Host: Rabbit. Target Name: Trim35. Sample Type: Mouse Kidney lysates. Antibody Dilution: 1.0ug/ml
Western Blot: TRIM35 Antibody [NBP2-88471]

Western Blot: TRIM35 Antibody [NBP2-88471]

Western Blot: TRIM35 Antibody [NBP2-88471] - Host: Rabbit. Target Name: TRIM35. Sample Tissue: Mouse Mouse Spleen. Antibody Dilution: 1ug/ml

Applications for TRIM35 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM35

TRIM35 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.

Alternate Names

HLS5Hemopoietic lineage switch protein 5, KIAA1098MGC17233, MAIR, tripartite motif containing 35, tripartite motif-containing 35, tripartite motif-containing protein 35

Gene Symbol

TRIM35

Additional TRIM35 Products

Product Documents for TRIM35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRIM35 Antibody - BSA Free

Customer Reviews for TRIM35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM35 Antibody - BSA Free and earn rewards!

Have you used TRIM35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies