TRIM45 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-53109
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to TRIM45(tripartite motif-containing 45) The peptide sequence was selected from the N terminal of TRIM45. Peptide sequence FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for TRIM45 Antibody - BSA Free
Western Blot: TRIM45 Antibody [NBP1-53109]
Western Blot: TRIM45 Antibody [NBP1-53109] - Hela cell lysate, concentration 0.2-1 ug/ml.Western Blot: TRIM45 Antibody - BSA Free [NBP1-53109] -
TRIM45 stabilizes and activates p53 in glioma cells. (a) Lysates of TRIM45-overexpressing and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-Flag antibodies. beta -Actin was used as a loading control. (b) Lysates of TRIM45 KO and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-TRIM45 antibodies. beta -Actin was used as a loading control. (c and d) The mRNA levels of p53 target genes in TRIM45 overexpression and KO U87 cells were analyzed using real-time PCR. (e) Luciferase activity in U87 cells transfected with p53-luc, p53, and an empty vector or a vector expressing TRIM45 (0, 200, and 400 ng). Results are presented as reporter gene activity relative to Renilla luciferase activity. (f and g) Immunoblot analysis of extracts of TRIM45 KO or control U87 cells treated for various times (as indicated above each lane) with CHX. (h and i) Lysates of TRIM45 KO and control U87 cells treated with MG132 or dimethyl sulfoxide (DMSO) were immunoblotted with anti-p53 and anti-TRIM45 antibodies. beta -Actin was used as a loading control. Each bar represents the mean+/-S.D. of three independent experiments. *P<0.05, **P<0.01, and ***P<0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28542145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TRIM45 Antibody - BSA Free [NBP1-53109] -
TRIM45 stabilizes and activates p53 in glioma cells. (a) Lysates of TRIM45-overexpressing and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-Flag antibodies. beta -Actin was used as a loading control. (b) Lysates of TRIM45 KO and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-TRIM45 antibodies. beta -Actin was used as a loading control. (c and d) The mRNA levels of p53 target genes in TRIM45 overexpression and KO U87 cells were analyzed using real-time PCR. (e) Luciferase activity in U87 cells transfected with p53-luc, p53, and an empty vector or a vector expressing TRIM45 (0, 200, and 400 ng). Results are presented as reporter gene activity relative to Renilla luciferase activity. (f and g) Immunoblot analysis of extracts of TRIM45 KO or control U87 cells treated for various times (as indicated above each lane) with CHX. (h and i) Lysates of TRIM45 KO and control U87 cells treated with MG132 or dimethyl sulfoxide (DMSO) were immunoblotted with anti-p53 and anti-TRIM45 antibodies. beta -Actin was used as a loading control. Each bar represents the mean+/-S.D. of three independent experiments. *P<0.05, **P<0.01, and ***P<0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28542145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TRIM45 Antibody - BSA Free [NBP1-53109] -
TRIM45 stabilizes and activates p53 in glioma cells. (a) Lysates of TRIM45-overexpressing and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-Flag antibodies. beta -Actin was used as a loading control. (b) Lysates of TRIM45 KO and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-TRIM45 antibodies. beta -Actin was used as a loading control. (c and d) The mRNA levels of p53 target genes in TRIM45 overexpression and KO U87 cells were analyzed using real-time PCR. (e) Luciferase activity in U87 cells transfected with p53-luc, p53, and an empty vector or a vector expressing TRIM45 (0, 200, and 400 ng). Results are presented as reporter gene activity relative to Renilla luciferase activity. (f and g) Immunoblot analysis of extracts of TRIM45 KO or control U87 cells treated for various times (as indicated above each lane) with CHX. (h and i) Lysates of TRIM45 KO and control U87 cells treated with MG132 or dimethyl sulfoxide (DMSO) were immunoblotted with anti-p53 and anti-TRIM45 antibodies. beta -Actin was used as a loading control. Each bar represents the mean+/-S.D. of three independent experiments. *P<0.05, **P<0.01, and ***P<0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28542145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TRIM45 Antibody - BSA Free [NBP1-53109] -
TRIM45 stabilizes and activates p53 in glioma cells. (a) Lysates of TRIM45-overexpressing and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-Flag antibodies. beta -Actin was used as a loading control. (b) Lysates of TRIM45 KO and control U87 and LN229 cells were immunoblotted with anti-p53, anti-PUMA, and anti-TRIM45 antibodies. beta -Actin was used as a loading control. (c and d) The mRNA levels of p53 target genes in TRIM45 overexpression and KO U87 cells were analyzed using real-time PCR. (e) Luciferase activity in U87 cells transfected with p53-luc, p53, and an empty vector or a vector expressing TRIM45 (0, 200, and 400 ng). Results are presented as reporter gene activity relative to Renilla luciferase activity. (f and g) Immunoblot analysis of extracts of TRIM45 KO or control U87 cells treated for various times (as indicated above each lane) with CHX. (h and i) Lysates of TRIM45 KO and control U87 cells treated with MG132 or dimethyl sulfoxide (DMSO) were immunoblotted with anti-p53 and anti-TRIM45 antibodies. beta -Actin was used as a loading control. Each bar represents the mean+/-S.D. of three independent experiments. *P<0.05, **P<0.01, and ***P<0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28542145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TRIM45 Antibody - BSA Free [NBP1-53109] -
TRIM45 inhibits glioma progression in vitro and in vivo. (a) Lysates of TRIM45-expressing and control U87 and LN229 cells were immunoblotted with anti-Flag antibody. beta -Actin was used as a loading control. (c) Lysates of TRIM45 KO and control U87 and LN229 cells were immunoblotted with an anti-TRIM45 antibody. beta -Actin was used as a loading control. (b and d) Growth curves were performed by plating a fixed number of cells in triplicate and counting cells at different time points. (e–h) Anchorage-independent growth assay of TRIM45-overexpressing (e and f) and TRIM45 KO (g and h) U87 and LN229 cells. Scale bars: 200 μm. (i–k) Xenograft tumors derived from LN229 cells transfected with TRIM45 or empty vector control lentivirus. Tumor growth (i), representative images of tumor growth (j) and the measured tumor weights (k) are presented. Each bar represents the mean+/-S.D. of three independent experiments. *P<0.05 and **P<0.01 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28542145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TRIM45 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TRIM45
Alternate Names
RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45
Gene Symbol
TRIM45
UniProt
Additional TRIM45 Products
Product Documents for TRIM45 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TRIM45 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TRIM45 Antibody - BSA Free
Customer Reviews for TRIM45 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TRIM45 Antibody - BSA Free and earn rewards!
Have you used TRIM45 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...