TRMT1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79968

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRMT1L Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRMT1L Antibody - BSA Free

Western Blot: TRMT1L Antibody [NBP1-79968]

Western Blot: TRMT1L Antibody [NBP1-79968]

Western Blot: TRMT1L Antibody [NBP1-79968] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for TRMT1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRMT1L

C1orf25 encodes a protein that has some similarity to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms. Studies of the mouse ortholog have shown that this protein plays a role in motor coordination and exploratory behavior, and it may also be involved in modulating postnatal neuronal functions. Alternatively spliced transcripts have been identified for this gene, but their full-length nature is not known.

Alternate Names

C1orf25MST070, chromosome 1 open reading frame 25, MGC25112, MGC57134, TRM1 tRNA methyltransferase 1-like, TRM1LbG120K12.3, TRM1-like protein

Gene Symbol

TRMT1L

Additional TRMT1L Products

Product Documents for TRMT1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRMT1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRMT1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRMT1L Antibody - BSA Free and earn rewards!

Have you used TRMT1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies