Recombinant Human Tryptase alpha/beta 1 His Protein
Novus Biologicals | Catalog # NBP2-22894
Key Product Details
Source
Accession Number
Tag
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Application Notes
Protein / Peptide Type
Scientific Data Images for Recombinant Human Tryptase alpha/beta 1 His Protein
SDS-PAGE: Recombinant Human Tryptase alpha/beta 1 His Protein [NBP2-22894]
SDS-Page of Recombinant Human Tryptase alpha/beta 1 His ProteinFormulation, Preparation, and Storage
NBP2-22894
| Formulation | 20 mM Tris-HCl buffer (pH8.0), 10% glycerol, 0.4M UREA |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Background: Tryptase alpha/beta-1
Alternate Names
Gene Symbol
UniProt
Additional Tryptase alpha/beta-1 Products
Product Documents for Recombinant Human Tryptase alpha/beta 1 His Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human Tryptase alpha/beta 1 His Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Recombinant Human Tryptase alpha/beta 1 His Protein
There are currently no reviews for this product. Be the first to review Recombinant Human Tryptase alpha/beta 1 His Protein and earn rewards!
Have you used Recombinant Human Tryptase alpha/beta 1 His Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review