TSSC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82367

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of TSSC3. Peptide sequence: MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TSSC3 Antibody - BSA Free

Western Blot: TSSC3 Antibody [NBP2-82367]

Western Blot: TSSC3 Antibody [NBP2-82367]

Western Blot: TSSC3 Antibody [NBP2-82367] - WB Suggested Anti-PHLDA2 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for TSSC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSSC3

GenBank Accession Number - NP_003302. TSSC3 in encoded in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Studies of the mouse gene, however, which is also located in an imprinted gene domain, have shown that the product of this gene regulates placental growth.

Alternate Names

Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein, BWR1Cp17-Beckwith-Wiedemann region 1 C, HLDA2BRW1C, Imprinted in placenta and liver protein, IPLp17-BWR1C, pleckstrin homology-like domain family A member 2, pleckstrin homology-like domain, family A, member 2, TSSC3p17-Beckwith-Wiedemann region 1C, tumor suppressing subchromosomal transferable fragment cDNA 3, tumor suppressing subtransferable candidate 3, Tumor-suppressing STF cDNA 3 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein, tumor-supressing STF cDNA 3

Gene Symbol

PHLDA2

Additional TSSC3 Products

Product Documents for TSSC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSSC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSSC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSSC3 Antibody - BSA Free and earn rewards!

Have you used TSSC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...