TWF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88523

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TWF2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TWF2. Peptide sequence: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TWF2 Antibody - BSA Free

Western Blot: TWF2 Antibody [NBP2-88523]

Western Blot: TWF2 Antibody [NBP2-88523]

Western Blot: TWF2 Antibody [NBP2-88523] - Host: Rabbit. Target Name: TWF2. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TWF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TWF2

TWF2, also known as Twinfilin-2, is a 349 amino acid protein that is 40 kDa, ubiquitously expressed at protein level, involved in motile and morphological processes, inhibits actin polymerization by sequestering G-actin, and regulates motility by capping the barbed ends. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles and participates in regulating the mature length of the middle and short rows of stereocilia. Current research is being performed on several diseases and disorders including monkeypox, cowpox, smallpox, vaccinia, meningioma, leukemia, and neuronitis. The TWF2 protein has shown an interaction with ARHGDIA, ACTR3B, CHGB, CAPZA1, and CAPZA2 in positive regulation of lamellipodium assembly, positive regulation of neuron projection development, cell projection organization, negative regulation of actin filament polymerization, and regulation of microvillus length pathways.

Alternate Names

A6-related protein, A6RPFLJ56277, hA6RP, Protein tyrosine kinase 9-like, protein tyrosine kinase 9-like (A6-related protein), PTK9L protein tyrosine kinase 9-like (A6-related protein), PTK9LA6r, twinfilin, actin-binding protein, homolog 2 (Drosophila), Twinfilin-1-like protein, twinfilin-2

Gene Symbol

TWF2

Additional TWF2 Products

Product Documents for TWF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TWF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TWF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TWF2 Antibody - BSA Free and earn rewards!

Have you used TWF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies