TXNDC12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10018

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TXNDC12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12 (NP_056997). Peptide sequence METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TXNDC12 Antibody - BSA Free

Western Blot: TXNDC12 Antibody [NBP3-10018]

Western Blot: TXNDC12 Antibody [NBP3-10018]

Western Blot: TXNDC12 Antibody [NBP3-10018] - Western blot analysis of TXNDC12 in Human Large Intestine Tumor lysates. Antibody dilution at 1ug/ml

Applications for TXNDC12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TXNDC12

TXNDC12 belongs to the thioredoxin superfamily (see TXN; MIM 187700). Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors (Liu et al., 2003 (PubMed 14557066)).(supplied by OMIM)

Alternate Names

AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)

Gene Symbol

TXNDC12

Additional TXNDC12 Products

Product Documents for TXNDC12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TXNDC12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TXNDC12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TXNDC12 Antibody - BSA Free and earn rewards!

Have you used TXNDC12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies