TXNIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52909

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TXNIP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TXNIP(thioredoxin interacting protein). The peptide sequence was selected from the C terminal of TXNIP (NP_006463). Peptide sequence: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TXNIP Antibody - BSA Free

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909] - Human Adult Placenta.
Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909]

Western Blot: TXNIP Antibody [NBP1-52909] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Human heart

Applications for TXNIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TXNIP

TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Alternate Names

HHCPA78, THIF, thioredoxin binding protein 2, thioredoxin interacting protein, Thioredoxin-binding protein 2, thioredoxin-interacting protein, upregulated by 1,25-dihydroxyvitamin D-3, VDUP1EST01027, Vitamin D3 up-regulated protein 1

Entrez Gene IDs

10628 (Human)

Gene Symbol

TXNIP

UniProt

Q9H3M7 (Human)

Additional TXNIP Products

Product Documents for TXNIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TXNIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TXNIP Antibody - BSA Free

Customer Reviews for TXNIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TXNIP Antibody - BSA Free and earn rewards!

Have you used TXNIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies