UBE3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54950

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody [NBP1-54950]

Western Blot: UBE3B Antibody [NBP1-54950]

Western Blot: UBE3B Antibody [NBP1-54950] - 293T cells lysate, concentration 0.2-1 ug/ml.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL inhibits the UBE3B-mediated tumorigenic potential of breast cancer cells.A Protein levels of Flag-VHL and Myc-UBE3B in the stable MDA-MB-231 cell line expressing Flag-VHL or Myc-UBE3B. B The cell proliferation rate was measured in the indicated MDA-MB-231 cells (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. hrs, hours. C, D Colony formation was conducted in the indicated MDA-MB-231 cells, and representative images from three experiments were shown in (C). Colony numbers (D) were quantified (mean +/- SD, n = 3). ****P < 0.0001, by 1-way ANOVA Tukey’s multiple comparisons test. E, F Invasion assays were carried out in the indicated MDA-MB-231 cells, and representative images from three experiments were shown in (E). Invaded cell numbers were quantified in (F) (mean +/- SD, n = 3). ****P < 0.0001, by 1-way ANOVA Tukey’s multiple comparisons test. G Protein levels of VHL and UBE3B were detected in control, VHL-KD#1, UBE3B-KD, and VHL- and UBE3B-double knockdown (VHL-KD#1 + UBE3B-KD) MDA-MB-231 cells. H Proliferation rate of control, VHL-KD#1, UBE3B-KD, and VHL-KD#1+UBE3B-KD MDA-MB-231 cells (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. hrs, hours. I–L Colony formation (I, J) and invasion (K, L) assays were performed in control, VHL-KD#1, UBE3B-KD, and VHL-KD#1+UBE3B-KD MDA-MB-231 cells, and the representative images from three experiments were shown. Colony numbers (J) and invaded cell numbers (L) were quantified (mean +/- SD, n = 3). ****P < 0.0001, by 1-way ANOVA Tukey’s multiple comparisons test. Scale bars: 100 μm. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) Flag-VHL. B Protein levels of endogenous UBE3B in control or VHL-knockdown (VHL-KD) MDA-MB-231 and T47D cells. C–F The half-life of UBE3B protein in MDA-MB-231 (C, D) or T47D (E, F) cells expressing Flag-VHL. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. G–J The half-life of UBE3B protein was analyzed in scrambled shRNA (SC) or VHL-KD MDA-MB-231 (G, H) or T47D (I, J) cells. Cells were treated with 10 μg/mL CHX for the indicated time (mean +/- SD, n = 3). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test. K, L UBE3B protein levels in Flag-VHL-expressing MDA-MB-231 (K) and T47D (L) cells with or without MG132 treatment. EV, empty vector. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL-mediated UBE3B ubiquitination is essential for VHL in suppressing breast tumor growth and metastasis.A–C Tumor images (A), tumor growth curves (B), and tumor weight (C) of mice bearing DKO+2P2A + Myc-UBE3B-WT, DKO+2P2A + Myc-UBE3B-DM, DKO+2P2A + Myc-UBE3B-WT+Flag-VHL, and DKO+2P2A + Myc-UBE3B-DM+Flag-VHL T47D tumors (mean +/- SD, n = 5). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test (B) or 1-way ANOVA Tukey’s multiple comparisons test (C). D–G Representative H&E and immunohistochemical staining of Ki-67, CC3, and endomucin in primary tumors. Scale bars: 100 μm. Ki-67-positive cell numbers (E), CC3-positive cell numbers (F), and microvessel density (G) were quantified. (mean +/- SD, n = 5). ***P < 0.001, ****P < 0.0001, by 1-way ANOVA Dunnett’s multiple comparisons test. ns no significance. H, I DKO+2P2A + Myc-UBE3B-WT, DKO+2P2A + Myc-UBE3B-DM, DKO+2P2A + Myc-UBE3B-WT+Flag-VHL, and DKO+2P2A + Myc-UBE3B-DM+Flag-VHL MDA-MB-231 cells were injected into mice through tail vein. Representative H&E-stained lung sections (H) and quantification of lung metastases by qPCR (I) (mean +/- SD, n = 4). ****P < 0.0001, 1-way ANOVA Tukey’s multiple comparisons test. Scale bars: 500 μm. J Immunoblots of lysates from paired normal (N) and breast cancer tissues (T). K Immunostaining of UBE3B and VHL in human breast cancer tissues. Scale bars: 25 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
UBE3B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UBE3B Antibody - BSA Free [NBP1-54950] -

VHL-mediated UBE3B ubiquitination is essential for VHL in suppressing breast tumor growth and metastasis.A–C Tumor images (A), tumor growth curves (B), and tumor weight (C) of mice bearing DKO+2P2A + Myc-UBE3B-WT, DKO+2P2A + Myc-UBE3B-DM, DKO+2P2A + Myc-UBE3B-WT+Flag-VHL, and DKO+2P2A + Myc-UBE3B-DM+Flag-VHL T47D tumors (mean +/- SD, n = 5). ****P < 0.0001, by 2-way ANOVA Tukey’s multiple comparisons test (B) or 1-way ANOVA Tukey’s multiple comparisons test (C). D–G Representative H&E and immunohistochemical staining of Ki-67, CC3, and endomucin in primary tumors. Scale bars: 100 μm. Ki-67-positive cell numbers (E), CC3-positive cell numbers (F), and microvessel density (G) were quantified. (mean +/- SD, n = 5). ***P < 0.001, ****P < 0.0001, by 1-way ANOVA Dunnett’s multiple comparisons test. ns no significance. H, I DKO+2P2A + Myc-UBE3B-WT, DKO+2P2A + Myc-UBE3B-DM, DKO+2P2A + Myc-UBE3B-WT+Flag-VHL, and DKO+2P2A + Myc-UBE3B-DM+Flag-VHL MDA-MB-231 cells were injected into mice through tail vein. Representative H&E-stained lung sections (H) and quantification of lung metastases by qPCR (I) (mean +/- SD, n = 4). ****P < 0.0001, 1-way ANOVA Tukey’s multiple comparisons test. Scale bars: 500 μm. J Immunoblots of lysates from paired normal (N) and breast cancer tissues (T). K Immunostaining of UBE3B and VHL in human breast cancer tissues. Scale bars: 25 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38914543), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for UBE3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE3B

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E3 ubiquitin-conjugating enzyme family. The encoded protein may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.

Alternate Names

DKFZp586K2123, DKFZp686A1051, EC 6.3.2, EC 6.3.2.-, FLJ45294, MGC131858, MGC78388, ubiquitin protein ligase E3B, ubiquitin-protein ligase E3B

Gene Symbol

UBE3B

UniProt

Additional UBE3B Products

Product Documents for UBE3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UBE3B Antibody - BSA Free

Customer Reviews for UBE3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE3B Antibody - BSA Free and earn rewards!

Have you used UBE3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...