UCP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88547

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all UCP3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UCP3. Peptide sequence: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UCP3 Antibody - BSA Free

Western Blot: UCP3 Antibody [NBP2-88547]

Western Blot: UCP3 Antibody [NBP2-88547]

Western Blot: UCP3 Antibody [NBP2-88547] - Host: Rabbit. Target Name: UCP3. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for UCP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UCP3

The uncoupling proteins (UCPs) are found in the inner mitochondrial membranes and belong to a family of mitochondrial anion transport proteins that include the phosphate and oxologutarate carriers and the ADP/ATP translocator. Three UCP subtypes have been identified and cloned. UCP 1 is abundantly expressed in brown adipose tissue of mammals. UCP 1 allows proton re-entry into the mitochondrial matrix without involving the F0-F1 ATPase which produces heat instead of ATP. It is thought that UCP 2 and 3 also dissipate the mitochondrial proton gradient produced by the respiratory chain in cells and tissues within which they are expressed. Studies have shown UCP 2 to be expressed by a variety of tissues. UCP 3 is expressed predominantly in brown adipose tissue, skeletal muscle, at lower levels in heart and smooth muscle, and is absent in liver and kidney.

Long Name

Uncoupling Protein 3 (Mitochondrial, Proton Carrier)

Alternate Names

SLC25A9

Gene Symbol

UCP3

Additional UCP3 Products

Product Documents for UCP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UCP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UCP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UCP3 Antibody - BSA Free and earn rewards!

Have you used UCP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies