VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55786

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VDR/NR1I1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: VDR/NR1I1/Vitamin D Receptor Antibody [NBP2-55786]

Immunocytochemistry/ Immunofluorescence: VDR/NR1I1/Vitamin D Receptor Antibody [NBP2-55786]

Immunocytochemistry/Immunofluorescence: VDR/NR1I1/Vitamin D Receptor Antibody [NBP2-55786] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VDR/NR1I1

Vitamin D Receptor encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein.

Long Name

Vitamin D [1,25-Dihydroxyvitamin D3] Receptor

Alternate Names

NR1I1

Gene Symbol

VDR

Additional VDR/NR1I1 Products

Product Documents for VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free and earn rewards!

Have you used VDR/NR1I1/Vitamin D Receptor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies