VHLL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84330

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VHLL Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VHLL. Peptide sequence: PWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VHLL Antibody - BSA Free

Western Blot: VHLL Antibody [NBP2-84330]

Western Blot: VHLL Antibody [NBP2-84330]

Western Blot: VHLL Antibody [NBP2-84330] - Host: Rabbit. Target Name: VHLL. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for VHLL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VHLL

Von Hippel-Lindau (VHL) tumor suppressor protein is a component of an E3 ubiquitin ligase complex that the selectivelyubiquitinates the alpha subunit of the hypoxia-inducible factor (HIF) transcription factor for proteasome-mediateddegradation. Inactivation of VHL causes VHL disease and sporadic kidney cancer. This gene encodes a VHL homolog thatlacks one of two key domains necessary for VHL function. It binds HIF alpha but fails to recruit the E3 ubiquitinligase complex, and therefore functions as a dominant-negative VHL and a protector of HIF alpha. This gene isintronless and predominantly expressed in the placenta, and may contribute to the regulation of oxygen homeostasis andneovascularization during placenta development. (provided by RefSeq)

Alternate Names

VHL-like protein, VHLP, VLPVHL pseudogene, von Hippel-Lindau tumor suppressor-like, von Hippel-Lindau-like protein

Gene Symbol

VHLL

Additional VHLL Products

Product Documents for VHLL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VHLL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VHLL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VHLL Antibody - BSA Free and earn rewards!

Have you used VHLL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies