VPS41 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88582

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human VPS41. Peptide sequence: DAASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VPS41 Antibody - BSA Free

Western Blot: VPS41 Antibody [NBP2-88582]

Western Blot: VPS41 Antibody [NBP2-88582]

Western Blot: VPS41 Antibody [NBP2-88582] - Host: Rabbit. Target Name: VPS41. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for VPS41 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VPS41

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known. (provided by RefSeq)

Alternate Names

HVPS41, hVps41p, HVSP41, S53, vacuolar assembly protein 41, vacuolar protein sorting 41 (yeast homolog), vacuolar protein sorting 41 (yeast), vacuolar protein sorting 41 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 41 homolog

Gene Symbol

VPS41

Additional VPS41 Products

Product Documents for VPS41 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VPS41 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS41 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VPS41 Antibody - BSA Free and earn rewards!

Have you used VPS41 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...