WASF3/WAVE3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-54992
Loading...
Key Product Details
Species Reactivity
Human, Chicken
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the N terminal of WASF3. Peptide sequence NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for WASF3/WAVE3 Antibody - BSA Free
Western Blot: WASF3/WAVE3 Antibody [NBP1-54992]
Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate.Western Blot: WASF3/WAVE3 Antibody [NBP1-54992]
Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - 1. DF-1 cells (0.5x106 cells loaded)2. MSB-1 cells (0.5x106 cells loaded) Primary Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1 : 10,000 Image Submitted By: Yongxiu YaoInstitute for Animal Health.Western Blot: WASF3/WAVE3 Antibody [NBP1-54992]
Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded) 2. MSB-1 cells (0.5x10^6 cells loaded) Primary Dilution: 1:1000 Secondary Antibody : Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1:10,000Applications for WASF3/WAVE3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: WASF3/WAVE3
Long Name
Wiskott-Aldrich Syndrome Protein Family Member 3
Alternate Names
Brush-1, SCAR3, WAVE3
Gene Symbol
WASF3
UniProt
Additional WASF3/WAVE3 Products
Product Documents for WASF3/WAVE3 Antibody - BSA Free
Product Specific Notices for WASF3/WAVE3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for WASF3/WAVE3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review WASF3/WAVE3 Antibody - BSA Free and earn rewards!
Have you used WASF3/WAVE3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...