WDR46 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83760

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR46. Peptide sequence: VDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRSSTASLVKRKRKVM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WDR46 Antibody - BSA Free

Western Blot: WDR46 Antibody [NBP2-83760]

Western Blot: WDR46 Antibody [NBP2-83760]

Western Blot: WDR46 Antibody [NBP2-83760] - Host: Rabbit. Target Name: WDR46. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for WDR46 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR46

WDR46 was originally identified as BING-4, a protein encoded in a gene-rich region of the major histocompatibility complex (MHC). WDR46 has been found to be overexpressed in a subset of melanoma cell lines and is a cancer antigen recognized by lymphocytes. WDR46 bears six WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. The function of WDR46 has not been characterized.

Alternate Names

BING4FP221, C6orf11, chromosome 6 open reading frame 11, WD repeat domain 46, WD repeat-containing protein 46, WD repeat-containing protein BING4

Gene Symbol

WDR46

Additional WDR46 Products

Product Documents for WDR46 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR46 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR46 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR46 Antibody - BSA Free and earn rewards!

Have you used WDR46 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...