WDR51A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09333

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WDR51A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat WDR51A (NP_001102766). Peptide sequence SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WDR51A Antibody - BSA Free

Western Blot: WDR51A Antibody [NBP3-09333]

Western Blot: WDR51A Antibody [NBP3-09333]

Western Blot: WDR51A Antibody [NBP3-09333] - Western blot analysis of WDR51A in Rat Pancreas as a positive control. Antibody dilution at 1.0 ug/ml

Applications for WDR51A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR51A

POC1 centriolar protein homolog A (POC1A), also known as Pix2 and WD repeat-containing protein 51A (WDR51A), is a member of the WD repeat POC1 family. WDR51A functions to control centriole length and duplication. Additionally, WDR51A is required for ciliogenesis and basal body formation. Mutations to the WDR51A gene result in short stature, onychodysplasia, facial dysmorphism, hypotrichosis (SOFT) syndrome, abnormal cellular mitotic mechanisms and impaired ciliogenesis.

Alternate Names

DKFZP434C245, MGC131902, PIX2, POC1 centriolar protein homolog A, POC1 centriolar protein homolog A (Chlamydomonas), WD repeat domain 51A, WD repeat-containing protein 51A, WDR51A

Gene Symbol

POC1A

Additional WDR51A Products

Product Documents for WDR51A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR51A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR51A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR51A Antibody - BSA Free and earn rewards!

Have you used WDR51A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies