WIPI2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86382

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI2. Peptide sequence: AFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLMASTS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WIPI2 Antibody - BSA Free

Western Blot: WIPI2 Antibody [NBP2-86382]

Western Blot: WIPI2 Antibody [NBP2-86382]

Western Blot: WIPI2 Antibody [NBP2-86382] - Host: Rabbit. Target Name: WIPI2. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: WIPI2 Antibody [NBP2-86382]

Western Blot: WIPI2 Antibody [NBP2-86382]

Western Blot: WIPI2 Antibody [NBP2-86382] - Host: Rabbit. Target Name: WIPI2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for WIPI2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WIPI2

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM]

Alternate Names

ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984, WD repeat domain phosphoinositide-interacting protein 2, WD repeat domain, phosphoinositide interacting 2, WD40 repeat protein interacting with phosphoinositides 2, WIPI-2, WIPI49-like protein 2

Gene Symbol

WIPI2

Additional WIPI2 Products

Product Documents for WIPI2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WIPI2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WIPI2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WIPI2 Antibody - BSA Free and earn rewards!

Have you used WIPI2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...