ZNF197 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86451

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF197 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF197. Peptide sequence: NLTVHQKIHTDEKPCECDVSEKEFSQTSNLHLQQKIHTIEEFSWLQNTNE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF197 Antibody - BSA Free

Western Blot: ZNF197 Antibody [NBP2-86451]

Western Blot: ZNF197 Antibody [NBP2-86451]

Western Blot: ZNF197 Antibody [NBP2-86451] - WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysate

Applications for ZNF197 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF197

ZNF197 product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

D3S1363E, P18, VHL-associated KRAB-A domain-containing protein, zinc finger protein 166, zinc finger protein 197, zinc finger protein 20, Zinc finger protein with KRAB and SCAN domains 9, ZKSCAN9VHLaK, ZNF166, ZNF20

Gene Symbol

ZNF197

Additional ZNF197 Products

Product Documents for ZNF197 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF197 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF197 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF197 Antibody - BSA Free and earn rewards!

Have you used ZNF197 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies