ZSCAN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83917

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZSCAN2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZSCAN2. Peptide sequence: TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZSCAN2 Antibody - BSA Free

Western Blot: ZSCAN2 Antibody [NBP2-83917]

Western Blot: ZSCAN2 Antibody [NBP2-83917]

Western Blot: ZSCAN2 Antibody [NBP2-83917] - WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate

Applications for ZSCAN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZSCAN2

The protein encoded by the ZSCAN2 gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

FLJ20595, ZFP29, zfp-29, zinc finger and SCAN domain containing 2, zinc finger and SCAN domain-containing protein 2, Zinc finger protein 29 homolog, Zinc finger protein 854, ZNF854zinc finger protein 29

Gene Symbol

ZSCAN2

Additional ZSCAN2 Products

Product Documents for ZSCAN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZSCAN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZSCAN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZSCAN2 Antibody - BSA Free and earn rewards!

Have you used ZSCAN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies