14-3-3 tau/theta Antibody (9G6M4)

Novus Biologicals | Catalog # NBP3-16722

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9G6M4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 tau/theta (P27348). MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 tau/theta Antibody (9G6M4)

Western Blot: 14-3-3 tau/theta Antibody (9G6M4) [NBP3-16722]

Western Blot: 14-3-3 tau/theta Antibody (9G6M4) [NBP3-16722]

Western Blot: 14-3-3 tau/theta Antibody (9G6M4) [NBP3-16722] - Western blot analysis of extracts of various cell lines, using 14-3-3 tau/theta Rabbit mAb (NBP3-16722) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
14-3-3 tau/theta Antibody (9G6M4)

Immunocytochemistry/ Immunofluorescence: 14-3-3 tau/theta Antibody (9G6M4) [NBP3-16722] -

Immunocytochemistry/ Immunofluorescence: 14-3-3 tau/theta Antibody (9G6M4) [NBP3-16722] - Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 tau/theta Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for 14-3-3 tau/theta Antibody (9G6M4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 theta

Members of the 14-3-3 family of proteins are highly conserved proteins, localized in neurons, and are axonally transported to the nerve terminals. They are also present, at lower levels, in various other eukaryotic tissues. 14-3-3 proteins appear to play important roles in a variety of signal transduction pathways, including those involved in cell cycle regulation and cell survival. Because 14-3-3 proteins bind to specific phosphoserine-containing sequences they are likely to have an important role in signaling pathways mediated by serine/threonine protein kinases. Evidence indicates 14-3-3 is required for Raf 1 kinase activity and phosphorylation among many other functions.

Alternate Names

14-3-3 protein tau, 1433 theta, HS1 protein, YWHAQ

Gene Symbol

YWHAQ

Additional 14-3-3 theta Products

Product Documents for 14-3-3 tau/theta Antibody (9G6M4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 14-3-3 tau/theta Antibody (9G6M4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 tau/theta Antibody (9G6M4)

There are currently no reviews for this product. Be the first to review 14-3-3 tau/theta Antibody (9G6M4) and earn rewards!

Have you used 14-3-3 tau/theta Antibody (9G6M4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies