5-HT2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55429

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for 5-HT2B Antibody - BSA Free

Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Immunocytochemistry/ Immunofluorescence: 5-HT2B Antibody [NBP1-55429]

Immunocytochemistry/ Immunofluorescence: 5-HT2B Antibody [NBP1-55429]

Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody [NBP1-55429] - Spinal Cord, ventral horns of mouse, 1.3ug/mL Image Submitted By: Timur Mavlyutov, PhD Department of Pharmacology University of Wisconsin Medical School
Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429]

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for 5-HT2B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT2B

5-HT2B, a Serotonin Receptor, activates phospholipase C upon binding serotonin, which results in a rise in intracellular calcium. It is known that 5-HT2B regulates cardiovascular function during development and in adulthood; mice lacking functional 5-HT2B receptors died of heart defects during gestation or neonatally, and adult mutant mice displayed cardiopathy, including myocyte disarray and ventricular dilation. Abnormal vascular proliferation causes an increase in pulmonary blood pressure, which is associated with an increase in 5-HT2B receptor, resulting in the development of pulmonary hypertension. It has also been reported that the 5-HT2B is involved in cell-cycle regulation via interaction with tyrosine kinase pathways. 5-HT2B receptors may have a role in the initiation of migraine headaches, and selective antagonists may prove therapeutic in migraine treatment. 5-HT2B receptor is expressed in many tissues including human liver, kidney, lung, heart, pancreas, spleen, brain, spinal cord, gastrointestinal tract, placenta, and coronary and pulmonary arteries. It has also been reported in embryonic mouse heart and spinal cord. ESTs have been isolated from heart/melanocyte/uterus, kidney, prostate, skin, and thyroid libraries.

Long Name

5-Hydroxytryptamine Receptor 2B

Alternate Names

5HT2B, HTR2B

Entrez Gene IDs

3357 (Human)

Gene Symbol

HTR2B

UniProt

Additional 5-HT2B Products

Product Documents for 5-HT2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 5-HT2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for 5-HT2B Antibody - BSA Free

Customer Reviews for 5-HT2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT2B Antibody - BSA Free and earn rewards!

Have you used 5-HT2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...