AGTRAP Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92060

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all AGTRAP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 93-152 of human AGTRAP (NP_065083.3). ILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AGTRAP Antibody - Azide and BSA Free

Western Blot: AGTRAP AntibodyAzide and BSA Free [NBP2-92060]

Western Blot: AGTRAP AntibodyAzide and BSA Free [NBP2-92060]

Western Blot: AGTRAP Antibody [NBP2-92060] - Analysis of extracts of various cell lines, using AGTRAP at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
AGTRAP Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: AGTRAP Antibody - Azide and BSA Free [NBP2-92060] -

Immunocytochemistry/ Immunofluorescence: AGTRAP Antibody - Azide and BSA Free [NBP2-92060] - Immunofluorescence analysis of U2OS cells using AGTRAP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for AGTRAP Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AGTRAP

AGTRAP encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

Alternate Names

angiotensin II receptor-associated protein, AT1 receptor-associated protein, ATI receptor-associated protein, MGC29646, type I receptor-associated protein, type-1 angiotensin II receptor-associated protein

Gene Symbol

AGTRAP

Additional AGTRAP Products

Product Documents for AGTRAP Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AGTRAP Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for AGTRAP Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review AGTRAP Antibody - Azide and BSA Free and earn rewards!

Have you used AGTRAP Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies