alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17799

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: alpha-2B Adrenergic R/ADRA2B Antibody [NBP3-17799]

Immunocytochemistry/ Immunofluorescence: alpha-2B Adrenergic R/ADRA2B Antibody [NBP3-17799]

Immunocytochemistry/Immunofluorescence: alpha-2B Adrenergic R/ADRA2B Antibody [NBP3-17799] - Staining of human cell line EFO-21 shows localization to vesicles.

Applications for alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha-2B Adrenergic R/ADRA2B

Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. This gene encodes the alpha2B subtype, which was observed to associate with eIF-2B, a guanine nucleotide exchange protein that functions in regulation of translation. A polymorphic variant of the alpha2B subtype, which lacks 3 glutamic acids from a glutamic acid repeat element, was identified to have decreased G protein-coupled receptor kinase-mediated phosphorylation and desensitization; this polymorphic form is also associated with reduced basal metabolic rate in obese subjects and may therefore contribute to the pathogenesis of obesity. This gene contains no introns in either its coding or untranslated sequences. (provided by RefSeq)

Long Name

Alpha-2B Adrenergic Receptor

Alternate Names

a-2B AdrenergicR, ADRA2B, ADRA2L1, ADRA2RL1, ADRARL1, alpha2B AdrenergicR

Gene Symbol

ADRA2B

Additional alpha-2B Adrenergic R/ADRA2B Products

Product Documents for alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free and earn rewards!

Have you used alpha-2B Adrenergic R/ADRA2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...