Associated Molecule with the SH3 Domain of STAM (AMSH), also known as STAM Binding Protein (STAMBP), is a 424 amino acid (aa) zinc metalloprotease member of the peptidase M67C class of enzymes with a predicted molecular weight of 50 kDa. The mouse and rat AMSH/STAMBP orthologs share 83% and 84% aa sequence identity with the human protein, respectively. AMSH/STAMBP is ubiquitously expressed and functions at endosomes where it opposes Ubiquitin-dependent sorting and recycling of receptors to lysosomes. The ability of AMSH/STAMBP to cleave K63-linked, but not K48-linked, poly-Ubiquitin chains is mediated by a JAMM motif (aa 335-348). Receptor substrates for AMSH/STAMBP include EGF R and Erb2. AMSH/STAMBP also functions in cytokine signaling and participates in cMyc induction by IL-2 or GM-CSF, as well as bone morphogenic protein (BMP) signaling via inhibition of Smad proteins. AMSH/STAMBP knockout mice show early-onset neurodegeneration and increased protein deposits in the brain, suggesting that AMSH/STAMBP may contribute to neurodegenerative diseases such as Alzheimer’s Disease, ALS, or Parkinson’s Disease.
AMSH/STAMBP Antibody (5S2I1)
Novus Biologicals | Catalog # NBP3-33217
Loading...
Key Product Details
Species Reactivity
Human, Monkey
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 5S2I1
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AMSH/STAMBP (O95630).
Sequence:
FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL
Sequence:
FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for AMSH/STAMBP Antibody (5S2I1)
Western Blot: AMSH/STAMBP Antibody (5S2I1) [NBP3-33217] -
Western Blot: AMSH/STAMBP Antibody (5S2I1) [NBP3-33217] - Western blot analysis of various lysates using AMSH/STAMBP Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Applications for AMSH/STAMBP Antibody (5S2I1)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: AMSH/STAMBP
Long Name
STAM Binding Protein
Alternate Names
AMSH, STAMBP
Gene Symbol
STAMBP
Additional AMSH/STAMBP Products
Product Documents for AMSH/STAMBP Antibody (5S2I1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AMSH/STAMBP Antibody (5S2I1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for AMSH/STAMBP Antibody (5S2I1)
There are currently no reviews for this product. Be the first to review AMSH/STAMBP Antibody (5S2I1) and earn rewards!
Have you used AMSH/STAMBP Antibody (5S2I1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...