Aquaporin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92557

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aquaporin-8 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Aquaporin-8 (NP_001160.2). MLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin-8 Antibody - BSA Free

Aquaporin-8 Antibody - BSA Free

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] -

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Western blot analysis of various lysates using Aquaporin-8 Rabbit pAb at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit.
Exposuretime: 90s.
Aquaporin-8 Antibody - BSA Free

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] -

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Western blot analysis of lysates from Rat liver, using Aquaporin-8 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Aquaporin-8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Aquaporin-8 Antibody - BSA Free [NBP2-92557] -

Immunocytochemistry/ Immunofluorescence: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Immunofluorescence analysis of NIH/3T3 cells using Aquaporin-8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Aquaporin-8 Antibody - BSA Free [NBP2-92557]

Immunocytochemistry/ Immunofluorescence: Aquaporin-8 Antibody - BSA Free [NBP2-92557]

Immunocytochemistry/Immunofluorescence: Aquaporin-8 Antibody [NBP2-92557] - Analysis of C6 cells using AQP8 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for Aquaporin-8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin-8

Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.

Alternate Names

AQP-8, aquaporin 8, aquaporin-8

Gene Symbol

AQP8

Additional Aquaporin-8 Products

Product Documents for Aquaporin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aquaporin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aquaporin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin-8 Antibody - BSA Free and earn rewards!

Have you used Aquaporin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies