BAF180/PB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55731

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAF180/PB1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BAF180/PB1 Antibody [NBP2-55731]

Immunocytochemistry/ Immunofluorescence: BAF180/PB1 Antibody [NBP2-55731]

Immunocytochemistry/Immunofluorescence: BAF180/PB1 Antibody [NBP2-55731] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.
BAF180/PB1 Antibody - BSA Free

BAF180/PB1 Antibody [NBP2-55731] -

Analysis using Anti-PBRM1 antibody (A) shows similar pattern to independent antibody (B).
BAF180/PB1 Antibody - BSA Free

BAF180/PB1 Antibody [NBP2-55731] -

ChIP-Exo-Seq composite graph for Anti-PBRM1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site.

Applications for BAF180/PB1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BAF180/PB1

The SMARCs (SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin), and BAFs (BRG1-associated factors), have been identified as components of the mammalian SWI/SNF-like chromatin-remodeling protein complexes. These multi-protein complexes are proposed to function as ATP-driven motors that translocate along DNA and destabilize nucleosomal structures to facilitate transcription factor binding. PB1/BAF180 is a component of the SWI/SNF-B (PBAF) complex. It contains six bromodomains which are defined by a 110 amino-acid module that interacts with acetylated lysine and is found in many chromatin binding proteins and histone acetyltransferases. PB1/BAF180 has been proposed to function as a tumor suppressor protein. Recently, PB1/BAF180 has been found to play a role in mediating cell cycle arrest in response to DNA damage via the regulation of the tumor suppressor p21. Alternate names for PB1/BAF180 include protein polybromo-1, polybromo-1D, BRG1-associated factor 180, hPB1, and PBRM1.

Long Name

Protein polybromo-1

Alternate Names

BAF180, hPB1, PB1, PBRM1, Polybromo-1D

Gene Symbol

PBRM1

Additional BAF180/PB1 Products

Product Documents for BAF180/PB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BAF180/PB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAF180/PB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BAF180/PB1 Antibody - BSA Free and earn rewards!

Have you used BAF180/PB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...