BarX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17808

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSESETEQPTPRQKKPRRSRTIF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BarX2 Antibody - BSA Free

Western Blot: BarX2 Antibody [NBP3-17808]

Western Blot: BarX2 Antibody [NBP3-17808]

Western Blot: BarX2 Antibody [NBP3-17808] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: BarX2 Antibody [NBP3-17808]

Immunocytochemistry/ Immunofluorescence: BarX2 Antibody [NBP3-17808]

Immunocytochemistry/Immunofluorescence: BarX2 Antibody [NBP3-17808] - Staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.

Applications for BarX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BarX2

BARX2 is a member of the Bar class of homeodomain transcription factors. It binds optimally to the DNA consensus sequence YYTAATGRTTTTY. It may control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. It may be involved in controlling adhesive processes in keratinizing epithelia. It is highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta. It contains 1 homeobox DNA-binding domain. BarX2 is a tumour suppressor gene that encodes for a transcription factor known to regulate transcription of cell adhesion molecules in the mouse.

Alternate Names

BarH-like homeobox 2, BARX homeobox 2, homeobox protein BarH-like 2, MGC133368, MGC133369

Gene Symbol

BARX2

Additional BarX2 Products

Product Documents for BarX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BarX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BarX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BarX2 Antibody - BSA Free and earn rewards!

Have you used BarX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...