Breast carcinoma amplified sequence 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58584

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Breast carcinoma amplified sequence 3 Antibody - BSA Free

Western Blot: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584]

Western Blot: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584]

Western Blot: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584]

Immunocytochemistry/ Immunofluorescence: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584]

Immunocytochemistry/Immunofluorescence: Breast carcinoma amplified sequence 3 Antibody [NBP2-58584] - Staining of human cell line U-2 OS shows localization to nucleoli.

Applications for Breast carcinoma amplified sequence 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Breast carcinoma amplified sequence 3

BCAS3 acts as an ERalpha coactivator in breast cancer cells. It has been demonstrated that PELP1, a newly described ERalpha coregulator, is recruited to BCAS3 chromatin and activates its expression. Analysis of the BCAS3 sequence for functional motifs and evidence from biochemical fractionation suggested that BCAS3 acts as a transcriptional coactivator. Results from chromatin immunoprecipitation, reporter assays, and expression studies further validated the coactivator function of BCAS3 for ERalpha. BCAS3 physically associated with histone H3 and histone acetyltransferase complex protein P/CAF and possessed histone acetyltransferase activity.

Alternate Names

BCAS4/BCAS3 fusion, breast carcinoma amplified sequence 3, breast carcinoma amplified sequence 4/3 fusion protein, breast carcinoma-amplified sequence 3, DKFZp686O1527, FLJ20128, GAOB1, MAAB, metastasis associated antigen of breast cancer, MGC4973, protein Maab1

Gene Symbol

BCAS3

Additional Breast carcinoma amplified sequence 3 Products

Product Documents for Breast carcinoma amplified sequence 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Breast carcinoma amplified sequence 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Breast carcinoma amplified sequence 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Breast carcinoma amplified sequence 3 Antibody - BSA Free and earn rewards!

Have you used Breast carcinoma amplified sequence 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...