c-Myc-responsive protein Rcl Antibody (7C1Z8)

Novus Biologicals | Catalog # NBP3-16115

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7C1Z8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 75-174 of human c-Myc-responsive protein Rcl (O43598). LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Western blot analysis of extracts of various cell lines, using c-Myc-responsive protein Rcl antibody (NBP3-16115) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
c-Myc-responsive protein Rcl Antibody (7C1Z8)

Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] -

Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Confocal imaging of MCF7 cells using c-Myc-responsive protein Rcl Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: c-Myc-responsive protein Rcl

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Alternate Names

chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, RCL, RP3-330M21.3

Gene Symbol

DNPH1

Additional c-Myc-responsive protein Rcl Products

Product Documents for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for c-Myc-responsive protein Rcl Antibody (7C1Z8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for c-Myc-responsive protein Rcl Antibody (7C1Z8)

There are currently no reviews for this product. Be the first to review c-Myc-responsive protein Rcl Antibody (7C1Z8) and earn rewards!

Have you used c-Myc-responsive protein Rcl Antibody (7C1Z8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...