Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CDK8 Antibody - BSA Free
Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]
Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of 200ug extracts of Jurkat cells, using CDK8 antibody. Western blot was performed from the immunoprecipitate using this antibodyWestern Blot: CDK8 AntibodyBSA Free [NBP2-92972]
Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts of Jurkat cells, using CDK8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Western Blot: CDK8 Antibody - BSA Free [NBP2-92972]
Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts from normal (control) and CDK8 knockout (KO) HeLa cells, using CDK8 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL KitApplications for CDK8 Antibody - BSA Free
Application
Recommended Usage
Immunoprecipitation
1:50 - 1:100
Western Blot
1:500 - 1:2000
Reviewed Applications
Read 1 review rated 5 using NBP2-92972 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CDK8
Long Name
Cyclin-dependent Kinase 8
Alternate Names
Protein kinase K35
Gene Symbol
CDK8
Additional CDK8 Products
Product Documents for CDK8 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CDK8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CDK8 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used CDK8 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: 293t HEK and U2OS cellsSpecies: HumanVerified Customer | Posted 03/31/2021left: Hek293 right: CDK Knock down
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- Immunoprecipitation Protocol
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...